ZFY Rabbit Polyclonal Antibody

CAT#: TA343386

Rabbit Polyclonal Anti-ZFY Antibody

Product Images

WB Suggested Anti-ZFX Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZFY antibody: synthetic peptide directed towards the N terminal of human ZFY. Synthetic peptide located within the following region: MDEDEFELQPQEPNSFFDGIGADATHMDGDQIVVEIQEAVFVSNIVDSDI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 90 kDa
• Gene Name: zinc finger protein, Y-linked
• Database Link:
  NP_003402
  Entrez Gene 7544 Human
  UniProt ID P08048
• Background: ZFY is a zinc finger-containing protein that may function as a transcription factor. ZFY was once a candidate gene for the testis-determining factor (TDF) and was erroneously referred to as TDF.This gene encodes a zinc finger-containing protein that may function as a transcription factor. This gene was once a candidate gene for the testis-determining factor (TDF) and was erroneously referred to as TDF. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: ZNF911
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Rat: 93%; Dog: 86%; Pig: 86%; Horse: 86%; Rabbit: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Transcription Factors