EPM2A Rabbit Polyclonal Antibody

CAT#: TA343303

Rabbit Polyclonal Anti-EPM2A Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of epilepsy, progressive myoclonus type 2A, Lafora disease (laforin) (EPM2A), transcript variant 1
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "EPM2A"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-EPM2A antibody is: synthetic peptide directed towards the N-terminal region of Human EPM2A. Synthetic peptide located within the following region: PGRVDTFWYKFLKREPGGELSWEGNGPHHDRCCTYNENNLVDGVYCLPIG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 34 kDa
Gene Name epilepsy, progressive myoclonus type 2A, Lafora disease (laforin)
Background This gene encodes a dual-specificity phosphatase that associates with polyribosomes. The encoded protein may be involved in the regulation of glycogen metabolism. Mutations in this gene have been associated with myoclonic epilepsy of Lafora. Alternative splicing results in multiple transcript variants.
Synonyms EPM2; MELF
Note Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Dog: 93%; Rabbit: 93%; Pig: 86%; Rat: 86%; Mouse: 86%
Reference Data
Protein Families Druggable Genome, Phosphatase

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.