Desmoglein 3 (DSG3) Rabbit Polyclonal Antibody

CAT#: TA343140

Rabbit Polyclonal Anti-DSG3 Antibody

Product Images

WB Suggested Anti-DSG3 Antibody; Titration: 1.0 ug/ml; Positive Control: HepG2 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DSG3 antibody: synthetic peptide directed towards the C terminal of human DSG3. Synthetic peptide located within the following region: KKLAEISLGVDGEGKEVQPPSKDSGYGIESCGHPIEVQQTGFVKCQTLSG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 102 kDa
• Gene Name: desmoglein 3
• Database Link:
  NP_001935
  Entrez Gene 1830 Human
  UniProt ID P32926
• Background: Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. Desmoglein 3 is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. Currently, three desmoglein subfamily members have been identified and all are members of the cadherin cell adhesion molecule superfamily. These desmoglein gene family members are located in a cluster on chromosome 18. This protein has been identified as the autoantigen of the autoimmune skin blistering disease pemphigus vulgaris.
• Synonyms: CDHF6; PVA
• Note: Immunogen Sequence Homology: Human: 100%