ZCCHC9 Rabbit Polyclonal Antibody
USD 436.00
USD 200.00
USD 867.00
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZCCHC9 antibody is: synthetic peptide directed towards the C-terminal region of Human ZCCHC9. Synthetic peptide located within the following region: KLCGSVEHLKKDCPESQNSERMVTVGRWAKGMSADYEEILDVPKPQKPKT |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 30 kDa |
Gene Name | zinc finger CCHC-type containing 9 |
Database Link | |
Background | The function of this protein remains unknown. |
Synonyms | PPP1R41 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 92%; Rabbit: 92%; Horse: 91%; Bovine: 85%; Rat: 83%; Pig; Mouse: 75% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review