SCGB2A1 Rabbit Polyclonal Antibody
Frequently bought together (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Recombinant protein of human secretoglobin, family 2A, member 1 (SCGB2A1), 20 µg
USD 867.00
Other products for "SCGB2A1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SCGB2A1 antibody is: synthetic peptide directed towards the N-terminal region of Human SCGB2A1. Synthetic peptide located within the following region: LEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 10 kDa |
Gene Name | secretoglobin family 2A member 1 |
Database Link | |
Background | SCGB2A1 may bind androgens and other steroids, may also bind estramustine, a chemotherapeutic agent used for prostate cancer. It may be under transcriptional regulation of steroid hormones. |
Synonyms | LPHC; LPNC; MGB2; UGB3 |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.