Germany
Japan
United Kingdom
China
SCGB2A1 Rabbit Polyclonal Antibody
Product Images
Frequently bought together (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Recombinant protein of human secretoglobin, family 2A, member 1 (SCGB2A1), 20 µg
USD 867.00
Other products for "SCGB2A1"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-SCGB2A1 antibody is: synthetic peptide directed towards the N-terminal region of Human SCGB2A1. Synthetic peptide located within the following region: LEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTL |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 10 kDa |
| Gene Name | secretoglobin family 2A member 1 |
| Database Link | |
| Background | SCGB2A1 may bind androgens and other steroids, may also bind estramustine, a chemotherapeutic agent used for prostate cancer. It may be under transcriptional regulation of steroid hormones. |
| Synonyms | LPHC; LPNC; MGB2; UGB3 |
| Note | Immunogen Sequence Homology: Human: 100% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.