HAUS8 Rabbit Polyclonal Antibody

CAT#: TA342771

Rabbit Polyclonal Anti-HAUS8 Antibody

Product Images

WB Suggested Anti-HAUS8 Antibody Titration: 0.125 ug/ml; ELISA Titer: 1:312500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HAUS8 antibody: synthetic peptide directed towards the N terminal of human HAUS8. Synthetic peptide located within the following region: QTRGKMSEGGRKSSLLQKSKADSSGVGKGDLQSTLLEGHGTAPPDLDLSA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: HAUS augmin like complex subunit 8
• Database Link:
  NP_219485
  Entrez Gene 93323 Human
  UniProt ID Q9BT25
• Background: HAUS8 is 1 of 8 subunits of the 390-kD human augmin complex, or HAUS complex. The augmin complex was first identified in Drosophila, and its name comes from the Latin verb 'augmentare,' meaning 'to increase.' The augmin complex is a microtubule-binding complex involved in microtubule generation within the mitotic spindle and is vital to mitotic spindle assembly (Goshima et al., 2008 [PubMed 18443220]; Uehara et al., 2009 [PubMed 19369198]).
• Synonyms: DGT4; HICE1; NY-SAR-48
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 75%