UBA6 Rabbit Polyclonal Antibody

CAT#: TA342595

Rabbit Polyclonal Anti-UBA6 Antibody

Product Images

WB Suggested Anti-UBA6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: HT1080 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UBA6 antibody: synthetic peptide directed towards the middle region of human UBA6. Synthetic peptide located within the following region: EVIVPHLTESYNSHRDPPEEEIPFCTLKSFPAAIEHTIQWARDKFESSFS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 118 kDa
• Gene Name: ubiquitin like modifier activating enzyme 6
• Database Link:
  NP_060697
  Entrez Gene 55236 Human
  UniProt ID A0AVT1
• Background: Modification of proteins with ubiquitin (UBB; MIM 191339) or ubiquitin-like proteins controls many signaling networks and requires a ubiquitin-activating enzyme (E1), a ubiquitin conjugating enzyme (E2), and a ubiquitin protein ligase (E3). UBE1L2 is an E1 enzyme that initiates the activation and conjugation of ubiquitin-like proteins (Jin et al., 2007 [PubMed 17597759]).
• Synonyms: E1-L2; MOP-4; UBE1L2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 83%

Reference Data

• Protein Pathways: Ubiquitin mediated proteolysis