Collagen XV (COL15A1) Rabbit Polyclonal Antibody

CAT#: TA342547

Rabbit Polyclonal Anti-Col15a1 Antibody

Product Images

Host: Rabbit Target Name: Col15a1 Sample Type: Rat Testis lysates Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Col15a1 antibody is: synthetic peptide directed towards the middle region of Rat Col15a1. Synthetic peptide located within the following region: ASGQPGMKGEKGARGPNGSVGEKGDPGSRGLPGPPGKNGEVGIPGAMGPP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 138 kDa
• Gene Name: collagen type XV alpha 1 chain
• Database Link:
  NP_001846
  Entrez Gene 298069 Rat
  UniProt ID P39059
• Background: The function of this protein remains unknown.
• Synonyms: FLJ38566
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Zebrafish: 91%