ZNF367 Rabbit Polyclonal Antibody

CAT#: TA342507

Reviews ()
Write a review

Rabbit Polyclonal Anti-Zfp367 Antibody



USD 375.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivity Rat
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Zfp367 antibody is: synthetic peptide directed towards the C-terminal region of Rat Zfp367. Synthetic peptide located within the following region: AAEWLAKYWEMREQRTPTLKGKLVQKADQEQQDPLEYLQSDEEDDEKSGA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 37 kDa
Gene Name zinc finger protein 367
Background Transcriptional activator. May be involved in transcriptional activation of erythroid genes.
Synonyms AFF29; CDC14B; ZFF29
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Guinea pig: 85%; Zebrafish: 79%
Reference Data
Protein Families Transcription Factors
Other products for "ZNF367"
Frequently bought together (2)
Transient overexpression lysate of zinc finger protein 367 (ZNF367)
    • 100 ug

USD 325.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies