SYBL1 (VAMP7) Rabbit Polyclonal Antibody

CAT#: TA342435

Rabbit Polyclonal Anti-VAMP7 Antibody

Product Images

WB Suggested Anti-VAMP7 Antibody Titration: 0.2-1 ug/ml; Positive Control: COLO205 cell lysate.VAMP7 is supported by BioGPS gene expression data to be expressed in COLO205

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-VAMP7 antibody: synthetic peptide directed towards the N terminal of human VAMP7. Synthetic peptide located within the following region: KIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFNFLNEIKK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: vesicle associated membrane protein 7
• Database Link:
  NP_005629
  Entrez Gene 6845 Human
  UniProt ID P51809
• Background: This gene encodes a transmembrane protein that is a member of the soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) family. The encoded protein localizes to late endosomes and lysosomes and is involved in the fusion of transport vesicles to their target membranes. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jun 2010]
• Synonyms: SYBL1; TI-VAMP; TIVAMP; VAMP-7
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%

Reference Data

• Protein Families: Transcription Factors, Transmembrane
• Protein Pathways: SNARE interactions in vesicular transport