ZNF91 Rabbit Polyclonal Antibody

CAT#: TA342423

Rabbit Polyclonal Anti-ZNF91 Antibody

Product Images

WB Suggested Anti-ZNF91 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF91 antibody: synthetic peptide directed towards the N terminal of human ZNF91. Synthetic peptide located within the following region: HKIIHAGEKLYKCEECGKAFNRSSNLTIHKFIHTGEKPYKCEECGKAFNW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 137 kDa
• Gene Name: zinc finger protein 91
• Database Link:
  NP_003421
  Entrez Gene 7644 Human
  UniProt ID Q05481
• Background: The ZNF91 gene encodes a zinc finger protein of the KRAB (Kruppel-associated box) subfamily (Bellefroid et al., 1991, 1993 [PubMed 2023909] [PubMed 8467795]). [supplied by OMIM, May 2010]. Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1). Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. ##Evidence-Data-START## Transcript exon combination :: DB068854.1, AK291256.1 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
• Synonyms: HPF7; HTF10
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 93%

Reference Data

• Protein Families: Transcription Factors