PTK9 (TWF1) Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of twinfilin, actin-binding protein, homolog 1 (Drosophila) (TWF1)
USD 436.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "PTK9"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TWF1 antibody: synthetic peptide directed towards the N terminal of human TWF1. Synthetic peptide located within the following region: MSHQTGIQASEDVKEIFARARNGKYRLLKISIENEQLVIGSYSQPSDSWD |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 44 kDa |
Gene Name | twinfilin actin binding protein 1 |
Database Link | |
Background | This gene encodes twinfilin, an actin monomer-binding protein conserved from yeast to mammals. Studies ofThe mouse counterpart suggest thatThis protein may be an actin monomer-binding protein, and its localization to cortical G-actin-rich structures may be regulated byThe small GTPase RAC1. [provided by RefSeq, Jul 2008] |
Synonyms | A6; PTK9 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Zebrafish: 79% |
Reference Data | |
Protein Families | Druggable Genome, Protein Kinase |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.