PTK9 (TWF1) Rabbit Polyclonal Antibody

CAT#: TA342180

Rabbit polyclonal Anti-TWF1 Antibody

Product Images

WB Suggested Anti-TWF1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TWF1 antibody: synthetic peptide directed towards the N terminal of human TWF1. Synthetic peptide located within the following region: MSHQTGIQASEDVKEIFARARNGKYRLLKISIENEQLVIGSYSQPSDSWD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: twinfilin actin binding protein 1
• Database Link:
  NP_002813
  Entrez Gene 5756 Human
  UniProt ID Q12792
• Background: This gene encodes twinfilin, an actin monomer-binding protein conserved from yeast to mammals. Studies ofThe mouse counterpart suggest thatThis protein may be an actin monomer-binding protein, and its localization to cortical G-actin-rich structures may be regulated byThe small GTPase RAC1. [provided by RefSeq, Jul 2008]
• Synonyms: A6; PTK9
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase