TMC2 Rabbit Polyclonal Antibody

SKU TA342093

Rabbit Polyclonal Anti-TMC2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMC2 antibody: synthetic peptide directed towards the middle region of human TMC2. Synthetic peptide located within the following region: YCWCWDLEAGFPSYAEFDISGNVLGLIFNQGMIWMGSFYAPGLVGINVLR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 102 kDa
• Gene Name: transmembrane channel like 2
• Database Link:
  NP_542789
  Q8TDI7
• Background: TMC2 is considered a member of transmembrane proteins family.The specific function ofThis gene is unknown; however, expression inThe inner ear suggests that it may be crucial for normal auditory function.This gene is considered a member of a gene family predicted to encode transmembrane proteins.The specific function ofThis gene is unknown; however, expression inThe inner ear suggests that it may be crucial for normal auditory function. Mutations inThis gene may underlie hereditary disorders of balance and hearing. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-382 AF417580.2 1-382 383-569 DA769512.1 96-282 570-859 DA769512.1 286-575 860-2736 AF417580.2 860-2736 2737-3169 AL049712.12 30165-30597 c
• Synonyms: C20orf145
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Rabbit: 85%

Reference Data

• Protein Families: Transmembrane