LY108 (SLAMF6) Rabbit Polyclonal Antibody

CAT#: TA342075

Rabbit Polyclonal Anti-SLAMF6 Antibody

Product Images

WB Suggested Anti-SLAMF6 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLAMF6 antibody: synthetic peptide directed towards the N terminal of human SLAMF6. Synthetic peptide located within the following region: EIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: SLAM family member 6
• Database Link:
  NP_443163
  Entrez Gene 114836 Human
  UniProt ID Q96DU3
• Background: SLAMF6 is a type I transmembrane protein, belonging toThe CD2 subfamily ofThe immunoglobulin superfamily. SLAMF6 is expressed on Natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and associates withThe Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It may function as a coreceptor inThe process of NK cell activation. It can also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients.The protein encoded byThis gene is a type I transmembrane protein, belonging toThe CD2 subfamily ofThe immunoglobulin superfamily.This encoded protein is expressed on Natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and associates withThe Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It may function as a coreceptor inThe process of NK cell activation. It can also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients. Publication Note:This RefSeq record includes a subset ofThe publications that are available forThis gene. Please seeThe Entrez Gene record to access additional publications.
• Synonyms: CD352; KALI; KALIb; Ly108; NTB-A; NTBA; SF2000
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane