Synaptogyrin 4 (SYNGR4) Rabbit Polyclonal Antibody

CAT#: TA341914

Rabbit Polyclonal Anti-SYNGR4 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of synaptogyrin 4 (SYNGR4)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "Synaptogyrin 4"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SYNGR4 antibody: synthetic peptide directed towards the N terminal of human SYNGR4. Synthetic peptide located within the following region: MHIPKSLQELANSEAVQFLRRPKTITRVFEGVFSLIVFSSLLTDGYQNKM
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 26 kDa
Gene Name synaptogyrin 4
Background This gene encodes an integral membrane protein.The gene belongs toThe synaptogyrin gene family. Like other members ofThe familyThe protein contains four transmembrane regions.The exact function ofThis protein is unclear. [provided by RefSeq, Jul 2008]
Synonyms MGC125805
Note Immunogen Sequence Homology: Human: 100%; Pig: 92%; Guinea pig: 92%; Dog: 86%; Rabbit: 86%; Bovine: 85%; Horse: 79%; Rat: 77%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.