BACE2 Rabbit Polyclonal Antibody

CAT#: TA341894

Reviews ()
Write a review

Rabbit Polyclonal Anti-BACE2 Antibody


 Product Datasheet for 'TA341894'

USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Clone Name Polyclonal
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-BACE2 antibody: synthetic peptide directed towards the N terminal of human BACE2. Synthetic peptide located within the following region: PAGAANFLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml
Predicted Protein Size 37 kDa
Gene Name beta-site APP-cleaving enzyme 2
Background This gene encodes an integral membrane glycoprotein that functions as an aspartic protease.The encoded protein cleaves amyloid precursor protein into amyloid beta peptide, which is a critical step inThe etiology of Alzheimer's disease and Down syndrome.The protein precursor is further processed into an active mature peptide. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Synonyms AEPLC; ALP56; ASP1; ASP21; BAE2; CDA13; CEAP1; DRAP
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%
Reference Data
Protein Families Druggable Genome, Protease, Transmembrane
Protein Pathways Alzheimer's disease
Other products for "BACE2"
Frequently bought together (2)
Transient overexpression lysate of beta-site APP-cleaving enzyme 2 (BACE2), transcript variant b
    • 100 ug

USD 315.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
40% off proteins and antibodies
68 Mouse Clones