B4gat1 Rabbit Polyclonal Antibody

CAT#: TA341869

Rabbit Polyclonal Anti-B3gnt1 Antibody

Product Images

Host: Rabbit; Target Name: B3gnt1; Sample Tissue: Mouse Testis lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-B3gnt1 antibody is: synthetic peptide directed towards the middle region of Mouse B3gnt1. Synthetic peptide located within the following region: RYEAAVPDPREPGEFALLRSCQEVFDKLARVAQPGINYALGTNTSYPNNL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: beta-1,4-glucuronyltransferase 1
• Database Link:
  NP_780592
  Entrez Gene 108902 Mouse
  UniProt ID Q8BWP8
• Background: Can initiateThe synthesis orThe elongation ofThe linear poly-N-acetyllactosaminoglycans. Involved in alpha-dystroglycan (DAG1) glycosylation.
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%