Tcea2 Rabbit Polyclonal Antibody

CAT#: TA341817

Rabbit Polyclonal Anti-Tcea2 Antibody

Product Images

Host: Rabbit; Target Name: Tcea2; Sample Tissue: Rat Spleen lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Tcea2 antibody is: synthetic peptide directed towards the middle region of Rat Tcea2. Synthetic peptide located within the following region: SVNALRKQSSDEELIALAKSLIKSWKKLLDVSDGKSRDQGRGTPLPTSSS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: transcription elongation factor A (SII), 2
• Database Link:
  NP_033352
  Entrez Gene 29575 Rat
  UniProt ID Q9QVN7
• Background: SII class transcription elongation factor; releases RNA polmerase II ternary complexes from transcriptional arrest at arresting sites; necessary for RNA polymerase II transcription elongation [RGD, Feb 2006]. ##Evidence-Data-START## Transcript exon combination :: D12927.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS160522, ERS160537 [ECO:0000348] ##Evidence-Data-END##
• Synonyms: OTTHUMP00000031638; TFIIS
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 93%