NKX2.3 (NKX2-3) Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of NK2 transcription factor related, locus 3 (Drosophila) (NKX2-3)
USD 436.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "NKX2.3"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-NKX2-3 antibody: synthetic peptide directed towards the middle region of mouse NKX2-3. Synthetic peptide located within the following region: GTHAPPPPPRRVAVPVLVRDGKPCVTPSAQTYGSPYGVGAGAYSYNSFPA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 40 kDa |
Gene Name | NK2 homeobox 3 |
Database Link | |
Background | NKX2C is a member ofThe NKX family of homeodomain-containing transcription factors, which are implicated in many aspects of cell type specification and maintenance of differentiated tissue functions. |
Synonyms | CSX3; NK2.3; NKX2.3; NKX2C; NKX4-3 |
Note | Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Dog: 85%; Pig: 85%; Bovine: 85%; Guinea pig: 85%; Human: 77% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.