RUNX2 Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of runt-related transcription factor 2 (RUNX2), transcript variant 1
USD 665.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "RUNX2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RUNX2 antibody: synthetic peptide directed towards the middle region of human RUNX2. Synthetic peptide located within the following region: DTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRM |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 57 kDa |
Gene Name | runt related transcription factor 2 |
Database Link | |
Background | This gene is a member ofThe RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain.This protein is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression.The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations inThis gene have been associated withThe bone development disorder cleidocranial dysplasia (CCD). Transcript variants that encode different protein isoforms result fromThe use of alternate promoters as well as alternate splicing. [provided by RefSeq, Jul 2008] |
Synonyms | AML3; CBF-alpha-1; CBFA1; CCD; CCD1; CLCD; OSF-2; OSF2; PEA2aA; PEBP2aA |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.