IFT140 Rabbit Polyclonal Antibody

CAT#: TA341669

Rabbit Polyclonal Anti-IFT140 Antibody

Product Images

Sample Type: 1. Human RPE cell line (15ug); 2. Bovine retina lysate cleared at 100,000Xg for 2 hours (15ug); Primary Dilution: 1:1000; Secondary Anditbody: goat anti-rabbit HRP; Scondary Dilution: 1:10,000; Image Submitted By: Gerald Liew; Stanford Univer

• 

  WB Suggested Anti-IFT140 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse, Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IFT140 antibody: synthetic peptide directed towards the N terminal of human IFT140. Synthetic peptide located within the following region: VLRWSPSGNCLLSGDRLGVLLLWRLDQRGRVQGTPLLKHEYGKHLTHCIF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 165 kDa
• Gene Name: intraflagellar transport 140
• Database Link:
  NP_055529
  Entrez Gene 106633 MouseEntrez Gene 9742 Human
  UniProt ID Q96RY7
• Background: This gene encodes one ofThe subunits ofThe intraflagellar transport (IFT) complex A. Intraflagellar transport is involved inThe genesis, resorption and signaling of primary cilia.The primary cilium is a microtubule-based sensory organelle atThe surface of most quiescent mammalian cells, that receives signals from its environment, such asThe flow of fluid, light or odors, and transduces those signals toThe nucleus. Loss ofThe corresponding protein in mouse results in renal cystic disease. [provided by RefSeq, Jun 2012]
• Synonyms: c305C8.4; c380F5.1; gs114; MZSDS; SRTD9; WDTC2
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Rabbit: 93%; Bovine: 92%