Annexin A13 (ANXA13) Rabbit Polyclonal Antibody
Frequently bought together (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "Annexin A13"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ANXA13 antibody: synthetic peptide directed towards the N terminal of human ANXA13. Synthetic peptide located within the following region: EPEAPQPAKASSPQGFDVDRDAKKLNKACKGMGTNEAAIIEILSGRTSDE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 39 kDa |
Gene Name | annexin A13 |
Database Link | |
Background | This gene encodes a member ofThe annexin family. Members ofThis calcium-dependent phospholipid-binding protein family play a role inThe regulation of cellular growth and in signal transduction pathways.The specific function ofThis gene has not yet been determined; however, it is associated withThe plasma membrane of undifferentiated, proliferating endothelial cells and differentiated villus enterocytes. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
Synonyms | ANX13; ISA |
Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 92%; Horse: 85%; Rabbit: 85%; Rat: 82%; Mouse: 82%; Dog: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.