Annexin A13 (ANXA13) Rabbit Polyclonal Antibody

CAT#: TA341658

Rabbit Polyclonal Anti-ANXA13 Antibody

Product Images

WB Suggested Anti-ANXA13 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Small Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ANXA13 antibody: synthetic peptide directed towards the N terminal of human ANXA13. Synthetic peptide located within the following region: EPEAPQPAKASSPQGFDVDRDAKKLNKACKGMGTNEAAIIEILSGRTSDE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: annexin A13
• Database Link:
  NP_001003954
  Entrez Gene 312 Human
  UniProt ID P27216
• Background: This gene encodes a member ofThe annexin family. Members ofThis calcium-dependent phospholipid-binding protein family play a role inThe regulation of cellular growth and in signal transduction pathways.The specific function ofThis gene has not yet been determined; however, it is associated withThe plasma membrane of undifferentiated, proliferating endothelial cells and differentiated villus enterocytes. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
• Synonyms: ANX13; ISA
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 92%; Horse: 85%; Rabbit: 85%; Rat: 82%; Mouse: 82%; Dog: 77%