PGBD3 Rabbit Polyclonal Antibody

CAT#: TA341632

Rabbit Polyclonal Anti-PGBD3 Antibody

Product Images

WB Suggested Anti-PGBD3 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1:62500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PGBD3 antibody: synthetic peptide directed towards the N terminal of human PGBD3. Synthetic peptide located within the following region: NLPGSLLHTAAYLIQDGSDAESDSDDPSYAPKDDSPDEVPSTFTVQQPPP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: piggyBac transposable element derived 3
• Database Link:
  NP_736609
  Entrez Gene 267004 Human
  UniProt ID Q8N328
• Background: This gene is a member of a small family of genes derived from piggyBac transposable elements.The encoded protein contains a zinc-ribbon domain characteristic of transposon-derived proteins and may function as a regulator of transcription. Naturally-occurring readthrough transcription occurs betweenThis gene andThe adjacent ERCC6 gene (GeneID 2074), and results in a fusion protein that shares sequence withThe product of each individual gene.The readthrough locus is represented by GeneID:101243544.There are several pseudogenes forThis gene on chromosomes 4, 5 and 12. [provided by RefSeq, Mar 2013]
• Synonyms: FLJ90201
• Note: Immunogen Sequence Homology: Human: 100%