ZNF502 Rabbit Polyclonal Antibody

CAT#: TA341430

Rabbit Polyclonal Anti-ZNF502 Antibody

Product Images

WB Suggested Anti-ZNF502 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF502 antibody: synthetic peptide directed towards the N terminal of human ZNF502. Synthetic peptide located within the following region: IDSSGIVVKRFQEDEYQDSTFEEKYACEGMKENSPREIAESCLFQEGGFG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 63 kDa
• Gene Name: zinc finger protein 502
• Database Link:
  NP_149987
  Entrez Gene 91392 Human
  UniProt ID Q8TBZ5
• Background: May be involved in transcriptional regulation.
• Synonyms: FLJ12515; FLJ14855
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Horse: 85%; Bovine: 85%; Rat: 83%; Dog: 77%

Reference Data

• Protein Families: Transcription Factors