CFAP251 Rabbit Polyclonal Antibody

CAT#: TA340350

Rabbit Polyclonal Anti-WDR66 Antibody

Product Images

WB Suggested Anti-WDR66 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-WDR66 antibody: synthetic peptide directed towards the N terminal of human WDR66. Synthetic peptide located within the following region: GELEEKTDRMPQDELGQERRDLEPENREEGQERRVSDIQSKAGISRESLV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 130 kDa
• Gene Name: WD repeat domain 66
• Database Link:
  NP_653269
  Entrez Gene 144406 Human
  UniProt ID Q8TBY9
• Background: WDR66 contains 9 WD repeats. The functions of WDR66 remain unknown.
• Synonyms: CaM-IP4
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 85%