C2orf65 (M1AP) Rabbit Polyclonal Antibody

CAT#: TA340316

Rabbit Polyclonal Anti-M1AP Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human chromosome 2 open reading frame 65 (C2orf65), 20 µg
    • 20 ug

USD 867.00


Transient overexpression lysate of chromosome 2 open reading frame 65 (C2orf65)
    • 100 ug

USD 436.00

Other products for "C2orf65"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-M1AP antibody is: synthetic peptide directed towards the middle region of HUMAN M1AP. Synthetic peptide located within the following region: EGLKDTDLARVRRFQVVEVTKGILEHVDSASPVEDTSNDESSILGTDIDL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 40 kDa
Gene Name meiosis 1 associated protein
Background This gene encodes a protein that is likely to function in progression of meiosis. A similar protein in mouse plays a role in gametogenesis in both sexes. Alternate splicing results in multiple transcript variants encoding different isoforms.
Synonyms C2orf65; D6Mm5e; SPATA37
Note Immunogen Sequence Homology: Human: 100%; Horse: 86%; Pig: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.