CANT1 Rabbit Polyclonal Antibody

CAT#: TA340307

Rabbit Polyclonal Anti-CANT1 Antibody

Product Images

WB Suggested Anti-CANT1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Small Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CANT1 antibody: synthetic peptide directed towards the middle region of human CANT1. Synthetic peptide located within the following region: VAVEWDKDHGVLESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQIEG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: calcium activated nucleotidase 1
• Database Link:
  NP_620148
  Entrez Gene 124583 Human
  UniProt ID Q8WVQ1
• Background: This protein encoded by this gene belongs to the apyrase family. It functions as a calcium-dependent nucleotidase with a preference for UDP. Mutations in this gene are associated with Desbuquois dysplasia with hand anomalies. Alternatively spliced transcr
• Synonyms: DBQD; DBQD1; SCAN-1; SCAN1; SHAPY
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Horse: 91%; Bovine: 79%; Rabbit: 79%

Reference Data

• Protein Families: Secreted Protein
• Protein Pathways: Purine metabolism, Pyrimidine metabolism