CCBE1 Rabbit Polyclonal Antibody

CAT#: TA340273

Rabbit Polyclonal Anti-CCBE1 Antibody

Product Images

WB Suggested Anti-CCBE1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: ACHN cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CCBE1 antibody: synthetic peptide directed towards the middle region of human CCBE1. Synthetic peptide located within the following region: PMGPSPDLSHIKQGRRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: collagen and calcium binding EGF domains 1
• Database Link:
  NP_597716
  Entrez Gene 147372 Human
  UniProt ID Q6UXH8
• Background: This gene is thought to function in extracellular matrix remodeling and migration. It is predominantly expressed in the ovary, but down regulated in ovarian cancer cell lines and primary carcinomas, suggesting its role as a tumour suppressor. Mutations in this gene have been associated with Hennekam lymphangiectasia-lymphedema syndrome, a generalized lymphatic dysplasia in humans.
• Synonyms: HKLLS1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%