MOBKL2A (MOB3A) Rabbit Polyclonal Antibody

CAT#: TA340258

Rabbit Polyclonal Anti-MOB3A Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of MOB1, Mps One Binder kinase activator-like 2A (yeast) (MOBKL2A)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human MOB1, Mps One Binder kinase activator-like 2A (yeast) (MOBKL2A), 20 µg
    • 20 ug

USD 867.00

Other products for "MOBKL2A"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MOB3A antibody: synthetic peptide directed towards the middle region of human MOB3A. Synthetic peptide located within the following region: EYRWQDEHKFRKPTALSAPRYMDLLMDWIEAQINNEDLFPTNVGTPFPKN
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 25 kDa
Gene Name MOB kinase activator 3A
Background MOB3A may regulate the activity of kinases.
Synonyms MOB-LAK; MOB1C; MOBKL2A; moblak
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Horse: 93%; Mouse: 93%; Bovine: 93%; Dog: 86%; Zebrafish: 86%; Pig: 80%; Guinea pig: 80%; Rabbit: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.