TRIB1 Rabbit Polyclonal Antibody

SKU TA340200

Rabbit Polyclonal Anti-TRIB1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRIB1 antibody: synthetic peptide directed towards the middle region of human TRIB1. Synthetic peptide located within the following region: TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 41 kDa
• Gene Name: tribbles pseudokinase 1
• Database Link:
  NP_079471
  Q96RU8
• Background: TRIB1 interacts with MAPK kinases and regulates activation of MAP kinases. TRIB1 may not display kinase activity.
• Synonyms: C8FW; GIG-2; GIG2; SKIP1; TRB-1; TRB1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 77%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase