Calpain 11 (CAPN11) Rabbit Polyclonal Antibody

CAT#: TA340149

Rabbit Polyclonal Anti-CAPN11 Antibody

Product Images

WB Suggested Anti-CAPN11 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CAPN11 antibody: synthetic peptide directed towards the N terminal of human CAPN11. Synthetic peptide located within the following region: NNSRLKAKGVGQHDNAQNFGNQSFEELRAACLRKGELFEDPLFPAEPSSL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 80 kDa
• Gene Name: calpain 11
• Database Link:
  NP_008989
  Entrez Gene 11131 Human
  UniProt ID Q9UMQ6
• Background: Calpains constitute a family of intracellular calcium-dependent cysteine proteases. There are eight members in this superfamily. They consist of a variable 80 kDa subunit and an invariant 30 kDa subunit. This calpain protein appears to have protease activity and calcium-binding ability. A similar mouse protein may play a functional role in spermatogenesis and in the regulation of calcium-dependent signal transduction events during meiosis.
• Synonyms: calpain11
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 92%; Rat: 91%; Horse: 86%; Goat: 85%; Sheep: 85%; Bovine: 85%; Mouse: 77%

Reference Data

• Protein Families: Druggable Genome