Ataxin 3 (ATXN3) Rabbit Polyclonal Antibody

CAT#: TA339685

Rabbit Polyclonal Anti-ATXN3 Antibody

Product Images

Lanes: Lane 1: 2 ug hATX3 (isoform2); Josephin domain (1-182); Lane 2: 2 ug hATX3 (isoform2); C-terminal truncated Atx3 (1-264); Lane 3: 2ug hATX3 (isoform2); Lane 4: 2ug other protein; Primary Antibody Dilution: 1: 10, 000; Secondary Antibody: Anti-rabbit

• 

  WB Suggested Anti-ATXN3 Antibody Titration: 0.2-1 ug/ml; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ATXN3 antibody: synthetic peptide directed towards the N terminal of human ATXN3. Synthetic peptide located within the following region: SIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNAL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: ataxin 3
• Database Link:
  NP_004984
  Entrez Gene 4287 Human
  UniProt ID P54252
• Background: Machado-Joseph disease, also known as spinocerebellar ataxia-3, is an autosomal dominant neurologic disorder. The protein encoded by this gene contains (CAG)n repeats in the coding region, and the expansion of these repeats from the normal 13-36 to 68-79 is one cause of Machado-Joseph disease. There is a negative correlation between the age of onset and CAG repeat numbers. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
• Synonyms: AT3; ATX3; JOS; MJD; MJD1; SCA3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 92%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors