ZNF312B (FEZF1) Rabbit Polyclonal Antibody

CAT#: TA339647

Rabbit Polyclonal Anti-FEZF1 Antibody

Product Images

WB Suggested Anti-FEZF1 Antibody Titration: 1 ug/ml; Positive Control: Hela cell lysate

• 

  Human Pancreas

• 

  Human Pancreas

• 

  Human Placenta

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FEZF1 antibody: synthetic peptide directed towards the C terminal of human FEZF1. Synthetic peptide located within the following region: CPTCGKGFCRNFDLKKHVRKLHDSSLGLARTPAGEPGTEPPPPLPQQPPM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: FEZ family zinc finger 1
• Database Link:
  NP_001019784
  Entrez Gene 389549 Human
  UniProt ID A0PJY2
• Background: FEZF1 is a transcription repressor. It is involved in the axonal projection and proper termination of olfactory sensory neurons (OSN). It plays a role in rostro-caudal patterning of the diencephalon and in prethalamic formation. Expression of the FEZF1 is required in OSN to cell-autonomously regulate OSN axon projections. FEZF1 regulates non-cell-autonomously the layer formation of the olfactory bulb development and the interneurons. It may be required for correct rostral migration of the interneuron progenitors.
• Synonyms: FEZ; HH22; ZNF312B
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Rabbit: 92%; Pig: 79%; Horse: 79%; Guinea pig: 79%