CRISPLD2 Rabbit Polyclonal Antibody

CAT#: TA339581

Rabbit Polyclonal Anti-CRISPLD2 Antibody

Product Images

WB Suggested Anti-CRISPLD2 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

• 

  Sample Type: 1. Human Lung Fibroblast cells (40ug); 2. Mouse lung cells (40ug); Primary dilution: 1: 2000; Secondary Antibody: Anti-rabbit IgG horseradish peroxidase; Secondary dilution: 1: 1000; Image Submitted by: Xinlei Chen; McGill University

• 

  CRISPLD2 antibody - N-terminal region validated by WB using human and mouse serum, human fetal lung cell culture at 0.5 ug/ml.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CRISPLD2 antibody: synthetic peptide directed towards the N terminal of human CRISPLD2. Synthetic peptide located within the following region: MSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: cysteine rich secretory protein LCCL domain containing 2
• Database Link:
  NP_113664
  Entrez Gene 78892 MouseEntrez Gene 83716 Human
  UniProt ID Q9H0B8
• Background: CRISPLD2 is a novel NSCLP candidate gene.
• Synonyms: CRISP11; LCRISP2
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 86%; Mouse: 86%

Reference Data

• Protein Families: Secreted Protein, Transmembrane