Apolipoprotein L 2 (APOL2) Rabbit Polyclonal Antibody

CAT#: TA339568

Rabbit Polyclonal Anti-APOL2 Antibody

Product Images

WB Suggested Anti-APOL2 Antibody Titration: 0.2-1 ug/ml; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-APOL2 antibody: synthetic peptide directed towards the middle region of human APOL2. Synthetic peptide located within the following region: DVVSLAYESKHLLEGAKSESAEELKKRAQELEGKLNFLTKIHEMLQPGQD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: apolipoprotein L2
• Database Link:
  NP_112092
  Entrez Gene 23780 Human
  UniProt ID Q9BQE5
• Background: This gene is a member of the apolipoprotein L gene family. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids or allow the binding of lipids to organelles. Two transcript variants encoding the same protein have been found for this gene.
• Synonyms: APOL-II; APOL3
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane