C10orf57 (TMEM254) Rabbit Polyclonal Antibody

CAT#: TA339545

Rabbit Polyclonal Anti-TMEM254 Antibody

Product Images

WB Suggested Anti-TMEM254 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C10orf57 antibody: synthetic peptide directed towards the middle region of human C10orf57. Synthetic peptide located within the following region: QSIPYQNLGPLGPFTQYLVDHHHTLLCNGYWLAWLIHVGESLYAIVLCKH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 14 kDa
• Gene Name: transmembrane protein 254
• Database Link:
  NP_079401
  Entrez Gene 80195 Human
  UniProt ID Q8TBM7
• Background: The exact function of C10orf57 is not known.
• Synonyms: bA369J21.6; C10orf57
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Bovine: 93%; Dog: 86%; Pig: 86%; Rat: 86%; Mouse: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane