C10orf57 (TMEM254) Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of chromosome 10 open reading frame 57 (C10orf57)
USD 436.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "C10orf57"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-C10orf57 antibody: synthetic peptide directed towards the middle region of human C10orf57. Synthetic peptide located within the following region: QSIPYQNLGPLGPFTQYLVDHHHTLLCNGYWLAWLIHVGESLYAIVLCKH |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 14 kDa |
Gene Name | transmembrane protein 254 |
Database Link | |
Background | The exact function of C10orf57 is not known. |
Synonyms | bA369J21.6; C10orf57 |
Note | Immunogen Sequence Homology: Horse: 100%; Human: 100%; Bovine: 93%; Dog: 86%; Pig: 86%; Rat: 86%; Mouse: 86%; Guinea pig: 86% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.