SCAND2 (SCAND2P) Rabbit Polyclonal Antibody

CAT#: TA339540

Rabbit Polyclonal Anti-SCAND2 Antibody

Product Images

WB Suggested Anti-SCAND2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SCAND2 antibody: synthetic peptide directed towards the n terminal of human SCAND2. Synthetic peptide located within the following region: MAVAVDQQIQTPSVQDLQIVKLEEDSHWEQEISLQGNYPGPETSCQSFWH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: SCAN domain containing 2 pseudogene
• Database Link:
  NP_071333
  Entrez Gene 54581 Human
• Background: The SCAN domain is a highly conserved, leucine-rich motif of approximately 60 aa originally found within a subfamily of zinc finger proteins. Functional studies have established that the SCAN box is a protein interaction domain that mediates both hetero- and homoprotein associations, and maybe involved in regulation of transcriptional activity.
• Synonyms: SCAND2
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transcription Factors