Bcat1 Rabbit Polyclonal Antibody

CAT#: TA339286

Rabbit Polyclonal Anti-Bcat1 Antibody


USD 539.00

2 Weeks*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "Bcat1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Bcat1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ACVVCPVSDILYKGQMLHIPTMENGPKLASRILGKLTDIQYGRVESDWTI
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 50 kDa
Gene Name branched chain aminotransferase 1, cytosolic
Background Catalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine.
Synonyms BCAT(c); BCT1; DKFZp686E12175; ECA39; MECA39; PNAS-121; PP18
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Sheep: 93%; Bovine: 93%; Rabbit: 93%; Mouse: 86%; Rat: 82%; Guinea pig: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.