PHF23 Rabbit Polyclonal Antibody

CAT#: TA339153

Rabbit Polyclonal Anti-PHF23

Product Images

WB Suggested Anti-PHF23 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PHF23 antibody: synthetic peptide directed towards the N terminal of human PHF23. Synthetic peptide located within the following region: LEAMAEPSPEDPPPTLKPETQPPEKRRRTIEDFNKFCSFVLAYAGYIPPS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: PHD finger protein 23
• Database Link:
  NP_077273
  Entrez Gene 79142 Human
  UniProt ID Q9BUL5
• Background: PHF23 contains 1 PHD-type zinc finger. It belongs to the PHF23 family. A chromosomal aberration involving PHF23, translocation t (11;17)(p15;p13) with NUP98, is found in a patient with acute myeloid leukemia (AML).
• Synonyms: hJUNE-1b
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors