Ints12 Rabbit Polyclonal Antibody

CAT#: TA339149

Rabbit Polyclonal Anti-Ints12

Product Images

Host: Rabbit; Target Name: Ints12; Sample Tissue: Rat Pancreas lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Ints12 antibody is: synthetic peptide directed towards the C-terminal region of Rat Ints12. Synthetic peptide located within the following region: SGNGNSATAGPTGSITSKTTSETSSSTSASLKGPTSQESQLNAMKRLQMV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: integrator complex subunit 12
• Database Link:
  NP_001007641
  Entrez Gene 295448 Rat
  UniProt ID Q68FR3
• Background: Ints12 is a component of the Integrator complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing. The Integrator complex is associated with the C-terminal domain (CTD) of RNA polymerase II largest subunit (POLR2A) and is recruited to the U1 and U2 snRNAs genes.
• Synonyms: INT12; OTTHUMP00000161875; PHF22; SBBI22
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 91%