TRIM16 Rabbit Polyclonal Antibody

CAT#: TA339131

Rabbit Polyclonal Anti-TRIM16 Antibody

Product Images

WB Suggested Anti-TRIM16 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRIM16 antibody: synthetic peptide directed towards the N terminal of human TRIM16. Synthetic peptide located within the following region: AELDLMAPGPLPRATAQPPAPLSPDSGSPSPDSGSASPVEEEDVGSSEKL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 64 kDa
• Gene Name: tripartite motif containing 16
• Database Link:
  NP_006461
  Entrez Gene 10626 Human
  UniProt ID O95361
• Background: This gene was identified as an estrogen and anti-estrogen regulated gene in epithelial cells stably expressing estrogen receptor. The protein encoded by this gene contains two B box domains and a coiled-coiled region that are characteristic of the B box zinc finger protein family. The proteins of this family have been reported to be involved in a variety of biological processes including cell growth, differentiation and pathogenesis. Expression of this gene was detected in most tissues. Its function, however, has not yet been determined. [provided by RefSeq, Jul 2008]
• Synonyms: EBBP
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 85%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors