SAMSN1 Rabbit Polyclonal Antibody

CAT#: TA338944

Rabbit Polyclonal Anti-SAMSN1 Antibody

Product Images

WB Suggested Anti-SAMSN1 Antibody Titration: 0.2-1 ug/ml; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SAMSN1 antibody: synthetic peptide directed towards the middle region of human SAMSN1. Synthetic peptide located within the following region: DISLNKSQLDDCPRDSGCYISSGNSDNGKEDLESENLSDMVHKIIITEPS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: SAM domain, SH3 domain and nuclear localization signals 1
• Database Link:
  NP_071419
  Entrez Gene 64092 Human
  UniProt ID Q9NSI8
• Background: SAMSN1 is a member of a novel gene family of putative adaptors and scaffold proteins containing SH3 and SAM (sterile alpha motif) domains (Claudio et al., 2001 [PubMed 11536050]). [supplied by OMIM, Mar 2008]. Transcript Variant: This variant (1) represents the predominant transcript and encodes isoform 1. ##Evidence-Data-START## Transcript exon combination :: AF222927.1, BC029112.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
• Synonyms: HACS1; NASH1; SASH2; SH3D6B; SLy2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%