RDH12 Rabbit Polyclonal Antibody

CAT#: TA338851

Rabbit Polyclonal Anti-RDH12 Antibody

Product Images

WB Suggested Anti-RDH12 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RDH12 antibody: synthetic peptide directed towards the middle region of human RDH12. Synthetic peptide located within the following region: AKRLQGTGVTTYAVHPGVVRSELVRHSSLLCLLWRLFSPFVKTAREGAQT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: retinol dehydrogenase 12 (all-trans/9-cis/11-cis)
• Database Link:
  NP_689656
  Entrez Gene 145226 Human
  UniProt ID Q96NR8
• Background: RDH12 is an NADPH-dependent retinal reductase whose highest activity is toward 9-cis and all-trans-retinol. RDH12 also plays a role in the metabolism of short-chain aldehydes but does not exhibit steroid dehydrogenase activity. Defects in this gene are a cause of Leber congenital amaurosis type 3 (LCA3). The protein encoded by this gene is an NADPH-dependent retinal reductase whose highest activity is toward 9-cis and all-trans-retinol. The encoded enzyme also plays a role in the metabolism of short-chain aldehydes but does not exhibit steroid dehydrogenase activity. Defects in this gene are a cause of Leber congenital amaurosis type 3 (LCA3).
• Synonyms: LCA13; RP53; SDR7C2
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 92%; Zebrafish: 92%; Pig: 86%; Horse: 86%; Bovine: 85%; Rabbit: 85%; Rat: 79%; Yeast: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Retinol metabolism