P2RX7 Rabbit Polyclonal Antibody

CAT#: TA338780

Rabbit Polyclonal Anti-P2RX7 Antibody

Product Images

WB Suggested Anti-P2RX7 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human heart

• 

  WB Suggested Anti-P2RX7 Antibody ; Positive Control: Lane 1: 50ug mock transfected HEK-293Lane 2: 50ug hP2X7 transfected HEK-293Lane 3: 50ug mP2X7 transfected HEK-293Lane 4: 50ug rP2X7 transfected HEK-293; Primary Antibody Dilution : 1:625; Secondary Anti

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-P2RX7 antibody: synthetic peptide directed towards the middle region of human P2RX7. Synthetic peptide located within the following region: VKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 69 kDa
• Gene Name: purinergic receptor P2X 7
• Database Link:
  NP_803176
  Entrez Gene 5027 Human
  UniProt ID Q99572
• Background: The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. Activation of this nuclear receptor by ATP in the cytoplasm may be a mechanism by which cellular activity can be coupled to changes in gene expression. Multiple alternatively spliced variants have been identified, most of which fit nonsense-mediated decay (NMD) criteria. [provided by RefSeq, Jul 2010]
• Synonyms: 7; ATP receptor; ligand-gated ion channel; MGC20089; P2X7; P2X7 receptor; P2X purinoceptor 7; P2Z receptor; purinergic receptor P2X; purinergic receptor P2X7
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 90%; Horse: 86%; Mouse: 86%; Rat: 85%; Dog: 79%; Pig: 79%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: ATP Receptors, Transmembrane
• Protein Pathways: Calcium signaling pathway, Neuroactive ligand-receptor interaction