KCNH2 Rabbit Polyclonal Antibody

CAT#: TA338747

Rabbit Polyclonal Anti-KCNH2 Antibody

Product Images

WB Suggested Anti-KCNH2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: OVCAR-3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KCNH2 antibody: synthetic peptide directed towards the middle region of human KCNH2. Synthetic peptide located within the following region: SQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 90 kDa
• Gene Name: potassium voltage-gated channel subfamily H member 2
• Database Link:
  NP_742054
  Entrez Gene 3757 Human
  UniProt ID Q12809
• Background: This gene encodes a voltage-activated potassium channel belonging to the eag family. It shares sequence similarity with the Drosophila ether-a-go-go (eag) gene. Mutations in this gene can cause long QT syndrome type 2 (LQT2). Transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Jul 2008]
• Synonyms: ERG-1; ERG1; H-ERG; HERG; HERG1; Kv11.1; LQT2; SQT1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Potassium, Transcription Factors, Transmembrane