TM4SF20 Rabbit Polyclonal Antibody

CAT#: TA338678

Rabbit Polyclonal Anti-TM4SF20 Antibody

Product Images

WB Suggested Anti-TM4SF20 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: HT1080 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TM4SF20 antibody: synthetic peptide directed towards the middle region of human TM4SF20. Synthetic peptide located within the following region: QALLKGPLMCNSPSNSNANCEFSLKNISDIHPESFNLQWFFNDSCAPPTG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: transmembrane 4 L six family member 20
• Database Link:
  NP_079071
  Entrez Gene 79853 Human
  UniProt ID Q53R12
• Background: The function of this protein remains unknown.
• Synonyms: PRO994; SLI5; TCCE518
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 83%; Rabbit: 83%; Dog: 77%

Reference Data

• Protein Families: Transmembrane