FNDC3B Rabbit Polyclonal Antibody

CAT#: TA338617

Rabbit Polyclonal Anti-FNDC3B Antibody

Product Images

WB Suggested Anti-FNDC3B Antibody Titration: 2.5 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FNDC3B antibody: synthetic peptide directed towards the N terminal of human FNDC3B. Synthetic peptide located within the following region: RARSSPKSNDSDLQEYELEVKRVQDILSGIEKPQVSNIQARAVVLSWAPP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: fibronectin type III domain containing 3B
• Database Link:
  NP_001128567
  Entrez Gene 64778 Human
  UniProt ID Q53EP0
• Background: FNDC3B may be a positive regulator of adipogenesis.
• Synonyms: FAD104; PRO4979; YVTM2421
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, Transmembrane