GABA A Receptor alpha 4 (GABRA4) Rabbit Polyclonal Antibody

CAT#: TA338503

Rabbit Polyclonal Anti-GABRA4 Antibody

Product Images

WB Suggested Anti-GABRA4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:2500; Positive Control: ACHN cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GABRA4 antibody: synthetic peptide directed towards the N terminal of human GABRA4. Synthetic peptide located within the following region: MVSAKKVPAIALSAGVSFALLRFLCLAVCLNESPGQNQKEEKLCTENFTR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: gamma-aminobutyric acid type A receptor alpha4 subunit
• Database Link:
  NP_000800
  Entrez Gene 2557 Human
  UniProt ID P48169
• Background: Gamma-aminobutyric acid (GABA) is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified. This gene encodes subunit alpha-4, which is involved in the etiology of autism and eventually increases autism risk through interaction with another subunit, gamma-aminobutyric acid receptor beta-1 (GABRB1). Alternatively spliced transcript variants encoding different isoforms have been found in this gene. [provided by RefSeq, Feb 2011]
• Synonyms: alpha 4; gamma-aminobutyric acid (GABA) A receptor; gamma-aminobutyric acid A receptor
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Rabbit: 93%; Bovine: 86%; Horse: 79%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Cys-loop Receptors, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction