Mannan Binding Lectin (MBL2) Rabbit Polyclonal Antibody

CAT#: TA338382

Rabbit Polyclonal Anti-MBL2 Antibody

Product Images

WB Suggested Anti-MBL2 Antibody Titration: 0.2-1 ug/ml; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MBL2 antibody: synthetic peptide directed towards the middle region of human MBL2. Synthetic peptide located within the following region: KEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24
• Gene Name: mannose binding lectin 2
• Database Link:
  NP_000233
  Entrez Gene 4153 Human
  UniProt ID P11226
• Background: This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognizes mannose and N-acetylglucosamine on many microorganisms, and is capable of activating the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases. [provided by RefSeq, Jul 2008]
• Synonyms: COLEC1; HSMBPC; MBL; MBL2D; MBP; MBP-C; MBP1; MBPD
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Horse: 92%; Rat: 77%; Goat: 77%; Sheep: 77%; Bovine: 77%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Complement and coagulation cascades