SEC14L1 Rabbit Polyclonal Antibody

CAT#: TA338303

Rabbit Polyclonal Anti-SEC14L1 Antibody

Product Images

WB Suggested Anti-SEC14L1 Antibody; Titration: 1.0 ug/ml; Positive Control: Jurkat Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SEC14L1 antibody is: synthetic peptide directed towards the N-terminal region of Human SEC14L1. Synthetic peptide located within the following region: GSDTVNEFKSEDGAIHVIERRCKLDVDAPRLLKKIAGVDYVYFVQKNSLN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 77 kDa
• Gene Name: SEC14 like lipid binding 1
• Database Link:
  NP_001137473
  Entrez Gene 6397 Human
  UniProt ID Q92503
• Background: The protein encoded by this gene belongs to the SEC14 cytosolic factor family. It has similarity to yeast SEC14 and to Japanese flying squid RALBP which suggests a possible role of the gene product in an intracellular transport system. Multiple alternatively spliced transcript variants have been found for this gene; some variants represent read-through transcripts that include exons from the upstream gene C17orf86.
• Synonyms: PRELID4A; SEC14L
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Pig: 92%; Horse: 92%; Mouse: 92%; Bovine: 92%; Guinea pig: 92%